PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462931990
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 506aa    MW: 55664.2 Da    PI: 9.9541
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462931990genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B351.42e-16287363684
                ..-HHHHTT-EE--HHH.HTT---..--SEEEEEE..TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
         B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltled..esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                ++ ++l +  l+l  +f++++g+++++   ++l++   s + W v    ++++g+y+++kGW+ F+++n LkegD+++F  
  462931990 287 INTNTLGRE-LSLATTFCRAIGLQETCM--IVLKTsmDSTKFWLVHG-SQRQKGSYLFAKGWRLFCQENSLKEGDICTFNE 363
                455555555.9*************9884..55555225558888888.5888899************************93 PP

2B336.58.6e-12414496487
                E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
         B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                + ++ ++  s+ l+l   f++e+g+ +++ +tl+   +s rsW+  +   k+s++++ + G   F+++ng+++gD+++F  +++
  462931990 414 KKISTNAIGSC-LYLLQAFCKEIGIREPSMITLKTSMSSPRSWQAHVLPYKYSSHHLQGLGSTMFCRDNGINAGDICTFNIVET 496
                44455555666.************9987765555555666*******99******************************97654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.73E-52085IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.3E-52382IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.7E-14129229IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.474131227IPR003340B3 DNA binding domain
SuperFamilySSF1019362.16E-16131229IPR015300DNA-binding pseudobarrel domain
CDDcd100172.07E-10132224No hitNo description
SMARTSM010196.2E-7134227IPR003340B3 DNA binding domain
PfamPF023628.8E-8143224IPR003340B3 DNA binding domain
SuperFamilySSF1019361.43E-13277361IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.2E-15280362IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.095281380IPR003340B3 DNA binding domain
SMARTSM010190.0035283378IPR003340B3 DNA binding domain
CDDcd100178.65E-9288361No hitNo description
PfamPF023621.7E-12293364IPR003340B3 DNA binding domain
SuperFamilySSF1019362.35E-10409504IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508637.274410506IPR003340B3 DNA binding domain
SMARTSM010190.36412503IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.0E-11413504IPR015300DNA-binding pseudobarrel domain
PfamPF023621.7E-8420496IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MAASGDPGAT AARKHLRVLL PFSRNRLRIP DELAREIGGA GGEALVVVPS GGKQVRPVEV  60
GQDGDGAFLG CGWRAFADAC GVGGGGGPVL PSSSSGTVAA AFDDSGCLRE LGTPIPPAAE  120
GTTSTKETAR KPQFISVLPT DFMQKMRLPS KFVQRYIPKE HMNNYIATVL GPLGKVYPIR  180
LELDRLDLFF AGGWSQFVAI HGITEADSLW LRYEGNICFT VKVFGPDGCQ RECKHMQRVP  240
QTSTLQEAGK QQEASFACIR KLKCKNKASL WRSAYKIGPP SWITKQINTN TLGRELSLAT  300
TFCRAIGLQE TCMIVLKTSM DSTKFWLVHG SQRQKGSYLF AKGWRLFCQE NSLKEGDICT  360
FNEATSASSR KHKIMYHKSG GKRQKQPKCS TSLRKASSRK RDVFEIGPPT WITKKISTNA  420
IGSCLYLLQA FCKEIGIREP SMITLKTSMS SPRSWQAHVL PYKYSSHHLQ GLGSTMFCRD  480
NGINAGDICT FNIVETTQWH VVITHL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975298.11e-122PREDICTED: putative B3 domain-containing protein Os04g0347400 isoform X1
TrEMBLA0A0A9S1930.0A0A0A9S193_ARUDO; Uncharacterized protein
STRINGSi012530m1e-108(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31640.11e-13B3 family protein